Information report for AT1G02900
Gene Details
|
|
Functional Descriptions
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0000035 — cotyledon vascular system — sistema vascular del cotiledón (Spanish, exact), 子葉維管系 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
- SALK_036331 — Early flowering under LD conditions.
Functional Keywords
Literature and News
- Association of six YFP-myosin XI-tail fusions with mobile plant cell organelles. DOI: 10.1186/1471-2229-7-6 ; PMID: 17288617
- Two class XI myosins function in organelle trafficking and root hair development in Arabidopsis. DOI: 10.1104/pp.107.113654 ; PMID: 18178669
- Head-neck domain of Arabidopsis myosin XI, MYA2, fused with GFP produces F-actin patterns that coincide with fast organelle streaming in different plant cells. DOI: 10.1186/1471-2229-8-74 ; PMID: 18598361
- Overlapping functions of the four class XI myosins in Arabidopsis growth, root hair elongation, and organelle motility. DOI: 10.1073/pnas.0810730105 ; PMID: 19060218
- A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles. DOI: 10.1104/pp.109.136853 ; PMID: 19369591
- Class XI myosins are required for development, cell expansion, and F-Actin organization in Arabidopsis. DOI: 10.1105/tpc.110.076315 ; PMID: 20581304
- Class XI Myosins Move Specific Organelles in Pollen Tubes and Are Required for Normal Fertility and Pollen Tube Growth in Arabidopsis. DOI: 10.1104/pp.15.01161 ; PMID: 26358416
- Arabidopsis Myosins XI1, XI2, and XIK Are Crucial for Gravity-Induced Bending of Inflorescence Stems. DOI: 10.3389/fpls.2016.01932 ; PMID: 28066484
- Measurement of enzymatic and motile activities of Arabidopsis myosins by using Arabidopsis actins. DOI: 10.1016/j.bbrc.2017.12.071 ; PMID: 29248727
- Myosin XI-B is involved in the transport of vesicles and organelles in pollen tubes of Arabidopsis thaliana. DOI: 10.1111/tpj.15505 ; PMID: 34559914
- A GUS/luciferase fusion reporter for plant gene trapping and for assay of promoter activity with luciferin-dependent control of the reporter protein stability. DOI: 10.1093/pcp/pcm081 ; PMID: 17597079
- Arabidopsis nonresponding to oxylipins locus NOXY7 encodes a yeast GCN1 homolog that mediates noncanonical translation regulation and stress adaptation. DOI: 10.1111/pce.13182 ; PMID: 29499090
- Capturing the phosphorylation and protein interaction landscape of the plant TOR kinase. DOI: 10.1038/s41477-019-0378-z ; PMID: 30833711
- Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases. DOI: 10.1104/pp.105.063495 ; PMID: 16126863
- Activation-tagged suppressors of a weak brassinosteroid receptor mutant. DOI: 10.1093/mp/ssp099 ; PMID: 19995721
- Soluble carbohydrates regulate auxin biosynthesis via PIF proteins in Arabidopsis. DOI: 10.1105/tpc.112.104794 ; PMID: 23209113
- The jasmonic acid signaling pathway is linked to auxin homeostasis through the modulation of YUCCA8 and YUCCA9 gene expression. DOI: 10.1111/tpj.12152 ; PMID: 23425284
- YUCCA8 and YUCCA9 overexpression reveals a link between auxin signaling and lignification through the induction of ethylene biosynthesis. DOI: 10.4161/psb.26363 ; PMID: 24022251
- The importance of localized auxin production for morphogenesis of reproductive organs and embryos in Arabidopsis. DOI: 10.1093/jxb/erv256 ; PMID: 26019252
- YUCCA-mediated auxin biogenesis is required for cell fate transition occurring during de novo root organogenesis in Arabidopsis. DOI: 10.1093/jxb/erw213 ; PMID: 27255928
- Local Transcriptional Control of YUCCA Regulates Auxin Promoted Root-Growth Inhibition in Response to Aluminium Stress in Arabidopsis. DOI: 10.1371/journal.pgen.1006360 ; PMID: 27716807
- YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance. DOI: 10.7717/peerj.2574 ; PMID: 27761349
- Coordination of matrix attachment and ATP-dependent chromatin remodeling regulate auxin biosynthesis and Arabidopsis hypocotyl elongation. DOI: 10.1371/journal.pone.0181804 ; PMID: 28746399
- An Improved Recombineering Toolset for Plants. DOI: 10.1105/tpc.19.00431 ; PMID: 31666295
- The Circadian Clock Influences the Long-Term Water Use Efficiency of Arabidopsis. DOI: 10.1104/pp.20.00030 ; PMID: 32179629
- Phytochrome B interacts with SWC6 and ARP6 to regulate H2A.Z deposition and photomorphogensis in Arabidopsis. DOI: 10.1111/jipb.13111 ; PMID: 33982818
- Jasmonic Acid-Dependent MYC Transcription Factors Bind to a Tandem G-Box Motif in the YUCCA8 and YUCCA9 Promoters to Regulate Biotic Stress Responses. DOI: 10.3390/ijms22189768 ; PMID: 34575927
- High temperature perception in leaves promotes vascular regeneration and graft formation in distant tissues. DOI: 10.1242/dev.200079 ; PMID: 35217857
- Tonoplast proton pumps regulate nuclear spacing of female gametophytes via mediating polar auxin transport in Arabidopsis. DOI: 10.3389/fpls.2022.1006735 ; PMID: 36176689
- Endogenous auxin maintains embryonic cell identity and promotes somatic embryo development in Arabidopsis. DOI: 10.1111/tpj.16024 ; PMID: 36345646
- and transport-mediated dynamic auxin distribution during seed development controls seed size in Arabidopsis. DOI: 10.1111/tpj.16109 ; PMID: 36648165
- PIN2/3/4 auxin carriers mediate root growth inhibition under conditions of boron deprivation in Arabidopsis. DOI: 10.1111/tpj.16324 ; PMID: 37235684
Gene Resources
- UniProt: A0A178WER1
- EMBL: CACRSJ010000104, CACSHJ010000087, LR881466
- AlphaFoldDB: A0A178WER1
- EnsemblPlants: AT1G02900.1
- Gramene: AT1G02900.1
- KEGG: ath:AT1G02900
- Orthologous matrix: WIPTIRS
- ExpressionAtlas: AT1G02900
- InterPro: IPR008801
- PANTHER: PTHR33136, PTHR33136:SF109
- OrthoDB: A0A178WER1
Sequences
cDNA Sequence
- >AT1G02900.1
AAAAAAAATCTTCAACAACTACAAAATTAAAAAATCGAGTCCACGCACTCACCATGTATATATAAACATTAACTTAAGCAATAATAACCAAACAAAAGAACCCAAAGAAAGGCAAGAAAATGGACAAGTCCTTTACTCTGTTCTTAACTCTTACGATTCTCGTCGTCTTCATCATCTCTTCACCTCCGGTCCAAGCCGGCTTCGCCAACGACCTCGGTGGTGTAGCATGGGCTACGACTGGAGACAATGGTTCAGGCTGCCACGGTTCAATAGCAGAGTGTATCGGGGCGGAGGAAGAAGAAATGGACTCAGAGATCAATAGAAGAATATTGGCGACCACAAAATACATAAGCTATCAGTCTTTGAAACGGAACAGTGTGCCTTGTTCAAGAAGAGGTGCGTCTTATTACAATTGTCAGAACGGAGCTCAGGCTAATCCTTATAGTCGTGGTTGCAGCAAAATTGCTCGTTGCAGGAGTTAGACCTACAAACAAGAAAGCTATCTTCTTGATCTTGACTTATGTTTTCTTTGATCCATCAAGCGTTTTCATTTTAATTAAATCTTTAAATATTCATCATGTCTCTGCACAATAGTAAAGACCTATGTTTTGATCAAATTGGGTTGATTTGTAATATTTTATGTGAATAATCATGGTCTTAATGATCCATGAAGTTGTTTGGTTTTTAATTATTACAAAGAGACGAGTATTCAAAGAGTTATTACCTACGTTTGATCAAACCGGGTTTGGTTTGTACCTCAGCCGCTTTCACAGTCGGATTGAATAACCGGTCTCAAGTTGCAACACACAAGTGACCAACTCTCAACCTAACCCTTACCAACTCTCGGCGCGTTT
CDS Sequence
- >AT1G02900.1
ATGGACAAGTCCTTTACTCTGTTCTTAACTCTTACGATTCTCGTCGTCTTCATCATCTCTTCACCTCCGGTCCAAGCCGGCTTCGCCAACGACCTCGGTGGTGTAGCATGGGCTACGACTGGAGACAATGGTTCAGGCTGCCACGGTTCAATAGCAGAGTGTATCGGGGCGGAGGAAGAAGAAATGGACTCAGAGATCAATAGAAGAATATTGGCGACCACAAAATACATAAGCTATCAGTCTTTGAAACGGAACAGTGTGCCTTGTTCAAGAAGAGGTGCGTCTTATTACAATTGTCAGAACGGAGCTCAGGCTAATCCTTATAGTCGTGGTTGCAGCAAAATTGCTCGTTGCAGGAGTTAG
Protein Sequence
- >AT1G02900.1
MDKSFTLFLTLTILVVFIISSPPVQAGFANDLGGVAWATTGDNGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS