Information report for AT1G02820
Gene Details
|
|
Functional Descriptions
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
- SALK_005087C — Seedlings screened in bulk via high throughput methods for responses to various stressors. Results are in comparison to Col-0.heat:no change,cold:no change,oxidative stress:no change,osmotic stress:no change,salt stress:no change,ABA:no change,hypoxia:no change.
- SALK_092917C — Seedlings screened in bulk via high throughput methods for responses to various stressors. Results are in comparison to Col-0.heat:no change,cold:increased,oxidative stress:increased,osmotic stress:increased,salt stress:no change,ABA:no change,hypoxia:no change.
Functional Keywords
- cauline leaf , inflorescence meristem , carpel , petal , stem , pollen , pollen tube cell , guard cell
Literature and News
- Arabidopsis thaliana expresses a second functional phytochelatin synthase. DOI: 10.1016/s0014-5793(01)02976-3 ; PMID: 11684101
- Functional identification of AtFao3, a membrane bound long chain alcohol oxidase in Arabidopsis thaliana. DOI: 10.1016/j.febslet.2004.07.086 ; PMID: 15358540
- The maize genome contains a helitron insertion. DOI: 10.1105/tpc.008375 ; PMID: 12566579
- Cloning and functional characterization of a phospholipid:diacylglycerol acyltransferase from Arabidopsis. DOI: 10.1104/pp.104.044354 ; PMID: 15247387
- Expression in yeast of a novel phospholipase A1 cDNA from Arabidopsis thaliana. DOI: 10.1111/j.1432-1033.2004.04317.x ; PMID: 15355352
- Involvement of the phospholipid sterol acyltransferase1 in plant sterol homeostasis and leaf senescence. DOI: 10.1104/pp.109.145672 ; PMID: 19923239
- Impaired sterol ester synthesis alters the response of Arabidopsis thaliana to Phytophthora infestans. DOI: 10.1111/tpj.12046 ; PMID: 23072470
- Structural Analysis of Phosphoserine Aminotransferase (Isoform 1) From the Enzyme Involved in the Phosphorylated Pathway of Serine Biosynthesis. DOI: 10.3389/fpls.2018.00876 ; PMID: 30034403
- HIGH STEROL ESTER 1 is a key factor in plant sterol homeostasis. DOI: 10.1038/s41477-019-0537-2 ; PMID: 31712757
- Excess sterols disrupt plant cellular activity by inducing stress-responsive gene expression. DOI: 10.1007/s10265-020-01181-4 ; PMID: 32185672
- Excess sterol accumulation affects seed morphology and physiology in Arabidopsis thaliana. DOI: 10.1080/15592324.2021.1872217 ; PMID: 33446024
- Characterization of the ERP gene family in Arabidopsis thaliana. DOI: 10.1080/15592324.2021.1913301 ; PMID: 33906568
- Over-Expression of Phosphoserine Aminotransferase-Encoding Gene (AtPSAT1) Prompts Starch Accumulation in L. turionifera under Nitrogen Starvation. DOI: 10.3390/ijms231911563 ; PMID: 36232863
- Cellular sterol ester synthesis in plants is performed by an enzyme (phospholipid:sterol acyltransferase) different from the yeast and mammalian acyl-CoA:sterol acyltransferases. DOI: 10.1074/jbc.M504459200 ; PMID: 16020547
- A homologue of the breast cancer-associated gene BARD1 is involved in DNA repair in plants. DOI: 10.1038/sj.emboj.7601313 ; PMID: 16957774
- Mutation of Arabidopsis BARD1 causes meristem defects by failing to confine WUSCHEL expression to the organizing center. DOI: 10.1105/tpc.108.058867 ; PMID: 18591352
- BARD1 may be renamed ROW1 because it functions mainly as a REPRESSOR OF WUSCHEL1. DOI: 10.4161/psb.4.1.7312 ; PMID: 19704708
- Homologs of breast cancer genes in plants. DOI: 10.3389/fpls.2011.00019 ; PMID: 22629260
Gene Resources
- UniProt: A0A178WJ88
- EMBL: CACRSJ010000104, LR881466, LUHQ01000001
- AlphaFoldDB: A0A178WJ88
- EnsemblPlants: AT1G02820.1
- Gramene: AT1G02820.1
- KEGG: ath:AT1G02820
- Orthologous matrix: ASETIYW
- ExpressionAtlas: AT1G02820
- InterPro: IPR004926
- PANTHER: PTHR33509, PTHR33509:SF39
Homologs
- Oryza sativa OsLEA9
Sequences
cDNA Sequence
- >AT1G02820.1
GAAAACAATAACTTTGGGTGAAAGCCTAAATTGACGCAGCCTATCTGCTCTGCTTCCTCTATATAAACCCTCCTCTCATCTCTCTTCCTTCTCATCTATCCTGCAAAGCATTTTGAAATCTGTCAAGAGAGATAGGACGACCAAGTTTGTTCGATCTCGTTGCCGCAAAAAGGTAACAGCAGTCATCAGATCAAGAACCTGAGAAACTTCTCTTTTGCGCTGTTTTTCTTCTTCTCCAAAACTCGTAAAACCTATAAACCACAATGGCTCGTTCTCTCGCTAACGCTAAGATCCAATCCGTCTTCGGCTCCGAAAAGCTCTCGAACGCCGTTTTCAGACGAGGGTTTGCCGCCGCAGCCAAAACGGCGTTAGATGGAAGCGTTTCGACCGCGGAGATGAAGAAGAGAGCTGGGGAAGCTTCAAGCGAGAAGGCACCATGGGTTCCAGATCCTAAAACCGGTTATTACAGACCGGAAACCGTTTCTGAGGAGATTGACCCGGCTGAGCTACGAGCTATTCTCTTGAACAACAAGCAATAAATTTATTAAAAACCGTATTTTTATTCATCAATGTTGTTTAATGAGGAGATTAGCAAAATGGGTTATTATGATCTTTTGTGGTGAATCCCATCTTATTCCGTTACCATTTCTGTAATAATCGTTTGATCTTATTATTTTGATCTTATTATTTATGAAGTTTTAAAGGCTTCCATCTTCCCATTAACAAAGATTTGCTATGACTCAAAGTGATGACAAAAAAAATACTTTAAAAAAATTCAATTGGTATAAATATTATTTTGACGAAACTACAAAGAAA
CDS Sequence
- >AT1G02820.1
ATGGCTCGTTCTCTCGCTAACGCTAAGATCCAATCCGTCTTCGGCTCCGAAAAGCTCTCGAACGCCGTTTTCAGACGAGGGTTTGCCGCCGCAGCCAAAACGGCGTTAGATGGAAGCGTTTCGACCGCGGAGATGAAGAAGAGAGCTGGGGAAGCTTCAAGCGAGAAGGCACCATGGGTTCCAGATCCTAAAACCGGTTATTACAGACCGGAAACCGTTTCTGAGGAGATTGACCCGGCTGAGCTACGAGCTATTCTCTTGAACAACAAGCAATAA
Protein Sequence
- >AT1G02820.1
MARSLANAKIQSVFGSEKLSNAVFRRGFAAAAKTALDGSVSTAEMKKRAGEASSEKAPWVPDPKTGYYRPETVSEEIDPAELRAILLNNKQ