Information report for AT1G01610
Gene Details
|
|
Functional Descriptions
- PO:0009001 — fruit — frucht (exact, German), fruto (exact, Spanish), 果実 (exact, Japanese), coenocarp (narrow), syncarp (narrow), aggregate fruit (broad), compound fruit (broad), dehiscent fruit (broad), diaspore (broad), indehiscent fruit (broad), multiple fruit (broad), propagule (broad)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009010 — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
- GO:0016020 — is active in — membrane
- GO:0010143 — acts upstream of or within — cutin biosynthetic process
- GO:0010143 — involved in — cutin biosynthetic process
- GO:0016791 — enables — phosphatase activity
- GO:0090447 — enables — glycerol-3-phosphate 2-O-acyltransferase activity
- GO:0009507 — located in — chloroplast
- gpat4/gpat8 — This double knock-out mutant has a 60-70% overall decrease in cutin monomer content in leaf and stem. The plant grew slowly. The water loss rate for rosettes was 4-fold greater than wild type. The mutant has an increased sensitivity to fungal pathogen. Defects in stomata structure.
Functional Keywords
- fruit , root , vascular leaf , flower , cauline leaf , inflorescence meristem , seed , carpel , petal , stem , pollen , guard cell
Literature and News
- Specific PP2A Catalytic Subunits Are a Prerequisite for Positive Growth Effects in Arabidopsis Co-Cultivated with Azospirillum brasilense and Pseudomonas simiae. DOI: 10.3390/plants10010066 ; PMID: 33396893
- Loss of LEUCINE CARBOXYL METHYLTRANSFERASE 1 interferes with metal homeostasis in Arabidopsis and enhances susceptibility to environmental stresses. DOI: 10.1016/j.jplph.2022.153843 ; PMID: 36265226
- Vascular associated death1, a novel GRAM domain-containing protein, is a regulator of cell death and defense responses in vascular tissues. DOI: 10.1105/tpc.104.022038 ; PMID: 15269331
- Comparative transcriptional profiling and evolutionary analysis of the GRAM domain family in eukaryotes. DOI: 10.1016/j.ydbio.2007.11.031 ; PMID: 18201690
- The Arabidopsis patatin-like protein 2 (PLP2) plays an essential role in cell death execution and differentially affects biosynthesis of oxylipins and resistance to pathogens. DOI: 10.1094/MPMI-22-4-0469 ; PMID: 19271961
- An essential role for the VASt domain of the Arabidopsis VAD1 protein in the regulation of defense and cell death in response to pathogens. DOI: 10.1371/journal.pone.0179782 ; PMID: 28683084
- Ethylene is one of the key elements for cell death and defense response control in the Arabidopsis lesion mimic mutant vad1. DOI: 10.1104/pp.107.106302 ; PMID: 17720753
- GTP-binding proteins in plants. DOI: 10.1007/s000180050287 ; PMID: 10188584
- Isolation and analysis of cDNAs encoding small GTP-binding proteins of Arabidopsis thaliana. DOI: 10.1016/0378-1119(91)90442-e ; PMID: 1748311
- A rab1 GTPase is required for transport between the endoplasmic reticulum and golgi apparatus and for normal golgi movement in plants. DOI: 10.1105/tpc.12.11.2201 ; PMID: 11090219
- Redistribution of membrane proteins between the Golgi apparatus and endoplasmic reticulum in plants is reversible and not dependent on cytoskeletal networks. DOI: 10.1046/j.0960-7412.2002.01252.x ; PMID: 11874578
- The Arabidopsis Rab GTPase family: another enigma variation. DOI: 10.1016/s1369-5266(02)00307-2 ; PMID: 12393015
- A network of rice genes associated with stress response and seed development. DOI: 10.1073/pnas.0737574100 ; PMID: 12684538
- The vegetative vacuole proteome of Arabidopsis thaliana reveals predicted and unexpected proteins. DOI: 10.1105/tpc.104.027078 ; PMID: 15539469
- A Rab-E GTPase mutant acts downstream of the Rab-D subclass in biosynthetic membrane traffic to the plasma membrane in tobacco leaf epidermis. DOI: 10.1105/tpc.105.031112 ; PMID: 15972698
- The early responses of Arabidopsis thaliana cells to cadmium exposure explored by protein and metabolite profiling analyses. DOI: 10.1002/pmic.200500543 ; PMID: 16502469
- Selective mobility and sensitivity to SNAREs is exhibited by the Arabidopsis KAT1 K+ channel at the plasma membrane. DOI: 10.1105/tpc.105.038950 ; PMID: 16531497
- Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes. DOI: 10.1186/1471-2164-7-81 ; PMID: 16615871
- Identification of plant promoter constituents by analysis of local distribution of short sequences. DOI: 10.1186/1471-2164-8-67 ; PMID: 17346352
- VPS9a, the common activator for two distinct types of Rab5 GTPases, is essential for the development of Arabidopsis thaliana. DOI: 10.1105/tpc.107.053876 ; PMID: 18055610
- Subcellular localization and functional analysis of the Arabidopsis GTPase RabE. DOI: 10.1104/pp.108.132092 ; PMID: 19233904
Gene Resources
- UniProt: A0A178W9F8
- EMBL: CACRSJ010000104, CACSHJ010000087, LR881466
- AlphaFoldDB: A0A178W9F8
- EnsemblPlants: AT1G01610.1
- Gramene: AT1G01610.1
- KEGG: ath:AT1G01610
- Orthologous matrix: GYMVHET
- ExpressionAtlas: AT1G01610
- InterPro: IPR002123, IPR023214, IPR056462
- PANTHER: PTHR15486, PTHR15486:SF61
- SUPFAM: SSF69593
- Gene3D: 3.40.50.1000
- OrthoDB: A0A178W9F8
- SWISS-MODEL: A0A178W9F8
- Conserved Domain Database: cd06551
Homologs
- Daucus carota DCAR_021378
Sequences
cDNA Sequence
- >AT1G01610.1
TTTAAAACCCCAAGGACCTTCCCTCTCTTTCTTTCCAAATCTCTCTTTATCTCTCTTTCTCTGTTTACTAAATCGCCAGTATTCGCCGCAAGAAAGATGTCTCCGGCGAAGAAGAGCCGAAGTTTTCCTCCGATAAGCGAGTGTAAAAGCAGAGAGTATGATTCGATCGCTGCGGATCTCGACGGGACTCTGCTTCTGTCAAGAAGCTCTTTCCCTTACTTCATGCTGGTGGCCATTGAAGCAGGTAGTCTCTTCCGTGGATTGATCCTTCTTCTTTCTCTTCCCATCGTCATCATCGCTTATCTCTTCGTCTCCGAATCTCTCGGAATCCAAATCCTTATCTTCATCTCCTTCGCCGGTATCAAGATCAAGAACATCGAACTCGTCTCTCGCGCCGTTCTTACACGGTTTTACGCGGCGGATGTGAGGAAAGATAGTTTTGAGGTGTTTGATAAATGTAAGAAGAGGAAAGTAGTGGTGACTGCGAATCCGATAGTGATGGTTGAGCCATTCGTCAAAGACTATTTGGGAGGAGATAAAGTTTTGGGAACAGAGATTGAAGTTAACCCCAAAACGATGAAAGCTACTGGTTTTGTGAAAAAGCCTGGTGTTCTTGTTGGTGATCTCAAGAGATTAGCCATCTTGAAAGAGTTCGGCGATGACTCACCGGATCTTGGCCTCGGTGACCGCACCTCCGATCACGATTTCATGTCCATTTGCAAGGAAGGTTACATGGTGCATGAGACCAAATCAGCCACAACAGTCCCTATAGAGAGTCTCAAGAACCGCATAATCTTCCATGATGGCCGTCTTGTCCAACGTCCGACCCCATTAAACGCCTTAATCATTTACCTTTGGCTTCCTTTCGGCTTCATGCTCTCTGTCTTCCGCGTCTACTTCAACCTCCCTTTACCCGAACGCTTCGTCCGCTACACTTACGAGATCCTCGGCATTCACCTCACAATCCGTGGCCACCGTCCTCCACCTCCTTCCCCCGGAAAACCTGGAAACCTCTACGTTCTCAACCACCGCACCGCCCTTGACCCCATTATCATCGCCATTGCTCTCGGCCGTAAGATCACATGTGTCACTTATAGTGTCTCTCGCCTCTCCCTGATGCTCTCACCCATTCCTGCTGTTGCTCTGACCCGAGACCGTGTCGCTGACGCAGCCCGCATGAGGCAACTCCTCGAGAAAGGTGATTTGGTGATCTGTCCTGAAGGCACAACGTGTAGAGAACCATATCTACTAAGGTTCAGTGCTCTATTTGCAGAGCTGAGCGACCGGATCGTGCCTGTGGCCATGAACTGCAAGCAAGGGATGTTCAACGGGACGACAGTTAGAGGTGTGAAATTCTGGGATCCGTACTTCTTCTTCATGAACCCCCGACCTAGCTACGAGGCCACTTTCTTGGACCGTTTGCCCGAAGAAATGACGGTAAACGGTGGTGGCAAGACTCCTTTTGAGGTGGCTAATTACGTTCAGAAGGTGATCGGTGGAGTTTTGGGGTTCGAATGTACTGAACTTACAAGGAAGGATAAGTATCTGTTGCTTGGAGGCAACGACGGAAAGGTTGAGTCTATCAATAAGACCAAGTCCATGGAGTAATAATCCAGCTAGTCTGGTTGCTGCTATTTTGCTTGGGAGTGAAGTTAGGTCTTTCGGGTTTTCCCAATTACTTTTTTTTTTGTTTTTTTTCATGTATTGTTCGAGGAAAATGTTTTGTTGAATATGCACTGGATAATGAAACTACATTTGAATCAAAGTACGTACATGTAGTGTACCATTTCCCCTTGCCTTAACTATGAATGATTTGTAAACTCACCTTGTATTATAAGATATCATAGAGAAAAACACATTCTCGACTCTTTTCATTAGAAGGGCGTTGAGTTGCTCGTGGAAGAACCGCAGTGGCG
CDS Sequence
- >AT1G01610.1
ATGTCTCCGGCGAAGAAGAGCCGAAGTTTTCCTCCGATAAGCGAGTGTAAAAGCAGAGAGTATGATTCGATCGCTGCGGATCTCGACGGGACTCTGCTTCTGTCAAGAAGCTCTTTCCCTTACTTCATGCTGGTGGCCATTGAAGCAGGTAGTCTCTTCCGTGGATTGATCCTTCTTCTTTCTCTTCCCATCGTCATCATCGCTTATCTCTTCGTCTCCGAATCTCTCGGAATCCAAATCCTTATCTTCATCTCCTTCGCCGGTATCAAGATCAAGAACATCGAACTCGTCTCTCGCGCCGTTCTTACACGGTTTTACGCGGCGGATGTGAGGAAAGATAGTTTTGAGGTGTTTGATAAATGTAAGAAGAGGAAAGTAGTGGTGACTGCGAATCCGATAGTGATGGTTGAGCCATTCGTCAAAGACTATTTGGGAGGAGATAAAGTTTTGGGAACAGAGATTGAAGTTAACCCCAAAACGATGAAAGCTACTGGTTTTGTGAAAAAGCCTGGTGTTCTTGTTGGTGATCTCAAGAGATTAGCCATCTTGAAAGAGTTCGGCGATGACTCACCGGATCTTGGCCTCGGTGACCGCACCTCCGATCACGATTTCATGTCCATTTGCAAGGAAGGTTACATGGTGCATGAGACCAAATCAGCCACAACAGTCCCTATAGAGAGTCTCAAGAACCGCATAATCTTCCATGATGGCCGTCTTGTCCAACGTCCGACCCCATTAAACGCCTTAATCATTTACCTTTGGCTTCCTTTCGGCTTCATGCTCTCTGTCTTCCGCGTCTACTTCAACCTCCCTTTACCCGAACGCTTCGTCCGCTACACTTACGAGATCCTCGGCATTCACCTCACAATCCGTGGCCACCGTCCTCCACCTCCTTCCCCCGGAAAACCTGGAAACCTCTACGTTCTCAACCACCGCACCGCCCTTGACCCCATTATCATCGCCATTGCTCTCGGCCGTAAGATCACATGTGTCACTTATAGTGTCTCTCGCCTCTCCCTGATGCTCTCACCCATTCCTGCTGTTGCTCTGACCCGAGACCGTGTCGCTGACGCAGCCCGCATGAGGCAACTCCTCGAGAAAGGTGATTTGGTGATCTGTCCTGAAGGCACAACGTGTAGAGAACCATATCTACTAAGGTTCAGTGCTCTATTTGCAGAGCTGAGCGACCGGATCGTGCCTGTGGCCATGAACTGCAAGCAAGGGATGTTCAACGGGACGACAGTTAGAGGTGTGAAATTCTGGGATCCGTACTTCTTCTTCATGAACCCCCGACCTAGCTACGAGGCCACTTTCTTGGACCGTTTGCCCGAAGAAATGACGGTAAACGGTGGTGGCAAGACTCCTTTTGAGGTGGCTAATTACGTTCAGAAGGTGATCGGTGGAGTTTTGGGGTTCGAATGTACTGAACTTACAAGGAAGGATAAGTATCTGTTGCTTGGAGGCAACGACGGAAAGGTTGAGTCTATCAATAAGACCAAGTCCATGGAGTAA
Protein Sequence
- >AT1G01610.1
MSPAKKSRSFPPISECKSREYDSIAADLDGTLLLSRSSFPYFMLVAIEAGSLFRGLILLLSLPIVIIAYLFVSESLGIQILIFISFAGIKIKNIELVSRAVLTRFYAADVRKDSFEVFDKCKKRKVVVTANPIVMVEPFVKDYLGGDKVLGTEIEVNPKTMKATGFVKKPGVLVGDLKRLAILKEFGDDSPDLGLGDRTSDHDFMSICKEGYMVHETKSATTVPIESLKNRIIFHDGRLVQRPTPLNALIIYLWLPFGFMLSVFRVYFNLPLPERFVRYTYEILGIHLTIRGHRPPPPSPGKPGNLYVLNHRTALDPIIIAIALGRKITCVTYSVSRLSLMLSPIPAVALTRDRVADAARMRQLLEKGDLVICPEGTTCREPYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPFEVANYVQKVIGGVLGFECTELTRKDKYLLLGGNDGKVESINKTKSME