Gene Details:

Functional Descriptions:

  • We report crystal structures of S. habrochaites MKS1, an atypical member of the α/β-hydrolase superfamily. Sequence comparisons revealed the MKS1 catalytic triad, Ala-His-Asn, as divergent to the traditional α/β-hydrolase triad, Ser-His-Asp.
  • Determination of the MKS1 structure points to a novel enzymatic mechanism dependent upon residues Thr-18 and His-243, confirmed by biochemical assays.
  • We confirmed the importance of this substrate binding mode by substituting several amino acids leading to an alteration in the acyl-chain length preference of MKS1.
  • We employ structure-guided mutagenesis and functional assays to demonstrate that MKS1, unlike enzymes from this hydrolase superfamily, is not an efficient hydrolase but instead catalyzes the decarboxylation of 3-keto acids.

Literature:

Gene Resources:

Orthologs:

Sequences:

cDNA Sequence
  • >Solyc01g008930.4.1
CDS Sequence
  • >GU987105
    ATGGAGAAAAGCATGTCGCCATTTGTTAAGAAGCACTTTGTGCTAGTTCATACTGCATTCCACGGAGCGTGGTGCTGGTACAAGATTGTGGCATTGATGAGATCTTCAGGGCATAATGTCACAGCTCTTGACTTGGGCGCTTCAGGGATCAACCCCAAACAGGCCCTCCAAATCCCAAATTTTTCTGATTACTTGAGTCCGCTAATGGAGTTCATGGCTTCACTCCCTGCAAATGAAAAAATAATTCTCGTAGGTCATGCCTTAGGTGGACTCGCCATTTCTAAAGCCATGGAGACCTTTCCAGAAAAGATTTCAGTTGCTGTATTTCTCAGTGGTCTAATGCCTGGTCCAAATATCGATGCAACCACCGTCTGCACTAAGGCTGGTAGTGCAGTGCTAGGTCAACTGGATAATTGTGTTACATACGAAAATGGACCAACGAATCCTCCAACCACTCTCATCGCAGGTCCCAAGTTCTTGGCAACTAATGTTTACCATCTGAGCCCAATTGAGGATTTGGCGCTGGCCACTGCACTAGTGAGGCCACTTTATTTATATCTCGCGGAAGATATTTCTAAGGAGGTAGTTCTTTCAAGCAAAAGATATGGATCCGTTAAGCGAGTGTTCATTGTTGCTACTGAAAATGATGCCTTAAAGAAAGAATTTCTAAAATTGATGATTGAAAAGAATCCACCTGATGAAGTGAAAGAGATCGAGGGGTCTGACCACGTGACCATGATGTCTAAGCCCCAACAACTTTTTACTACTCTTCTAAGCATCGCTAACAAGTATAAATAA
Protein Sequence
  • >GU987105
    MEKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK