Gene Details:
- Gene ID:
- Gene Symbol: MKS1
- Gene Name: Methylketone Synthase1
- Genome: Tomato Genome version SL4.0
- Species: Solanum lycopersicum
Functional Descriptions:
- We report crystal structures of S. habrochaites MKS1, an atypical member of the α/β-hydrolase superfamily. Sequence comparisons revealed the MKS1 catalytic triad, Ala-His-Asn, as divergent to the traditional α/β-hydrolase triad, Ser-His-Asp.
- Determination of the MKS1 structure points to a novel enzymatic mechanism dependent upon residues Thr-18 and His-243, confirmed by biochemical assays.
- We confirmed the importance of this substrate binding mode by substituting several amino acids leading to an alteration in the acyl-chain length preference of MKS1.
- We employ structure-guided mutagenesis and functional assays to demonstrate that MKS1, unlike enzymes from this hydrolase superfamily, is not an efficient hydrolase but instead catalyzes the decarboxylation of 3-keto acids.
Function-related keywords:
Literature:
- Emergent decarboxylase activity and attenuation of α/β-hydrolase activity during the evolution of methylketone biosynthesis in tomato. DOI: 10.1105/tpc.111.093997 ; PMID: 22523203
Related News:
Gene Resources:
- NCBI ID: GU987105
- UniProt accessions:
Orthologs:
Sequences:
cDNA Sequence
- >Solyc01g008930.4.1
CDS Sequence
- >GU987105
ATGGAGAAAAGCATGTCGCCATTTGTTAAGAAGCACTTTGTGCTAGTTCATACTGCATTCCACGGAGCGTGGTGCTGGTACAAGATTGTGGCATTGATGAGATCTTCAGGGCATAATGTCACAGCTCTTGACTTGGGCGCTTCAGGGATCAACCCCAAACAGGCCCTCCAAATCCCAAATTTTTCTGATTACTTGAGTCCGCTAATGGAGTTCATGGCTTCACTCCCTGCAAATGAAAAAATAATTCTCGTAGGTCATGCCTTAGGTGGACTCGCCATTTCTAAAGCCATGGAGACCTTTCCAGAAAAGATTTCAGTTGCTGTATTTCTCAGTGGTCTAATGCCTGGTCCAAATATCGATGCAACCACCGTCTGCACTAAGGCTGGTAGTGCAGTGCTAGGTCAACTGGATAATTGTGTTACATACGAAAATGGACCAACGAATCCTCCAACCACTCTCATCGCAGGTCCCAAGTTCTTGGCAACTAATGTTTACCATCTGAGCCCAATTGAGGATTTGGCGCTGGCCACTGCACTAGTGAGGCCACTTTATTTATATCTCGCGGAAGATATTTCTAAGGAGGTAGTTCTTTCAAGCAAAAGATATGGATCCGTTAAGCGAGTGTTCATTGTTGCTACTGAAAATGATGCCTTAAAGAAAGAATTTCTAAAATTGATGATTGAAAAGAATCCACCTGATGAAGTGAAAGAGATCGAGGGGTCTGACCACGTGACCATGATGTCTAAGCCCCAACAACTTTTTACTACTCTTCTAAGCATCGCTAACAAGTATAAATAA
Protein Sequence
- >GU987105
MEKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK